The domain within your query sequence starts at position 709 and ends at position 755; the E-value for the C1 domain shown below is 3.15e-8.

RTHRLRKLRTPAKCRECNSYVYFQGAECEECCLACHKKCLETLAIQC

C1

Protein kinase C conserved region 1 (C1) domains (Cysteine-rich domains)

• SMART accession number: SM00109
• Description: Some bind phorbol esters and diacylglycerol. Some bind RasGTP. Zinc-binding domains.
• Interpro abstract (IPR002219):

  Diacylglycerol (DAG) is an important second messenger. Phorbol esters (PE) are analogues of DAG and potent tumour promoters that cause a variety of physiological changes when administered to both cells and tissues. DAG activates a family of serine/threonine protein kinases, collectively known as protein kinase C (PKC) [ (PUBMED:1396661) ]. Phorbol esters can directly stimulate PKC. The N-terminal region of PKC, known as C1, has been shown [ (PUBMED:2500657) ] to bind PE and DAG in a phospholipid and zinc-dependent fashion. The C1 region contains one or two copies (depending on the isozyme of PKC) of a cysteine-rich domain, which is about 50 amino-acid residues long, and which is essential for DAG/PE-binding. The DAG/PE-binding domain binds two zinc ions; the ligands of these metal ions are probably the six cysteines and two histidines that are conserved in this domain.

• GO process: intracellular signal transduction (GO:0035556)

There are 58922 C1 domains in 42393 proteins in SMART's nrdb database.

Cellular role (predicted cellular role)

Binding / catalysis: diacylglycerol-binding, phorbol-ester binding, zinc-binding, RasGTP-binding

Literature (relevant references for this domain)

Primary literature is listed below; Automatically-derived, secondary literature is also avaliable.

• Hurley JH, Newton AC, Parker PJ, Blumberg PM, Nishizuka Y
• Taxonomy and function of C1 protein kinase C homology domains.
• Protein Sci. 1997; 6: 477-80

C1 domains are compact alpha/beta structural units of about 50 amino acids which tightly bind two zinc ions. These domains were first discovered as the loci of phorbol ester and diacylglycerol binding to conventional protein kinase C isozymes, which contain 2 C1 domains (C1A and C1B) in their N-terminal regulatory regions. We present a comprehensive list of 54 C1 domains occurring singly or doubly in 34 different proteins. Many C1 domains and C1 domain-containing proteins bind phorbol esters, but many others do not. By combining analysis of 54 C1 domain sequences with information from previously reported solution and crystal structure determinations and site-directed mutagenesis, profiles are derived and used to classify C1 domains. Twenty-six C1 domains fit the profile for phorbol-ester binding and are termed "typical." Twenty-eight other domains fit the profile for the overall C1 domain fold but do not fit the profile for phorbol ester binding, and are termed "atypical." Proteins containing typical C1 domains are predicted to be regulated by diacylglycerol, whereas those containing only atypical domains are not.

• Xu RX, Pawelczyk T, Xia TH, Brown SC
• NMR structure of a protein kinase C-gamma phorbol-binding domain and study of protein-lipid micelle interactions.
• Biochemistry. 1997; 36: 10709-17

Classical protein kinase C (PKC) family members are activated by the binding of various ligands to one of several cysteine-rich domains of the enzyme. The natural agonist, diacylglycerol (DAG), and the natural product superagonist, phorbol dibutyrate (PDB), activate the enzyme to produce wide-ranging physiological effects. The second cysteine-rich (Cys2) domain of rat brain PKC-gamma was expressed and labeled with 15N and 13C, and the solution structure was determined to high resolution using multidimensional heteronuclear NMR methods. The phorbol binding site was identified by titrating this domain with phorbol-12,13-dibutyrate (PDB) in the presence of organic cosolvents. Titrations of this domain with lipid micelles, in the absence and presence of phorbols, indicate selective broadening of some resonances. The observed behavior indicates conformational exchange between bound and free states upon protein-micelle interaction. The data also suggest that half of the domain, including the phorbol site and one of the zinc sites, is capable of inserting into membranes.

• Mott HR, Carpenter JW, Zhong S, Ghosh S, Bell RM, Campbell SL
• The solution structure of the Raf-1 cysteine-rich domain: a novel ras and phospholipid binding site.
• Proc Natl Acad Sci U S A. 1996; 93: 8312-7

The Raf-1 protein kinase is the best-characterized downstream effector of activated Ras. Interaction with Ras leads to Raf-1 activation and results in transduction of cell growth and differentiation signals. The details of Raf-1 activation are unclear, but our characterization of a second Ras-binding site in the cysteine-rich domain (CRD) and the involvement of both Ras-binding sites in effective Raf-1-mediated transformation provides insight into the molecular aspects and consequences of Ras-Raf interactions. The Raf-1 CRD is a member of an emerging family of domains, many of which are found within signal transducing proteins. Several contain binding sites for diacylglycerol (or phorbol esters) and phosphatidylserine and are believed to play a role in membrane translocation and enzyme activation. The CRD from Raf-1 does not bind diacylglycerol but interacts with Ras and phosphatidylserine. To investigate the ligand-binding specificities associated with CRDs, we have determined the solution structure of the Raf-1 CRD using heteronuclear multidimensional NMR. We show that there are differences between this structure and the structures of two related domains from protein kinase C (PKC). The differences are confined to regions of the CRDs involved in binding phorbol ester in the PKC domains. Since phosphatidylserine is a common ligand, we expect its binding site to be located in regions where the structures of the Raf-1 and PKC domains are similar. The structure of the Raf-1 CRD represents an example of this family of domains that does not bind diacylglycerol and provides a framework for investigating its interactions with other molecules.

• Palmer RH, Ridden J, Parker PJ
• Cloning and expression patterns of two members of a novel protein-kinase-C-related kinase family.
• Eur J Biochem. 1995; 227: 344-51

The cDNA clones for two members of a novel protein kinase family were isolated and sequenced. These protein-kinase-C-related kinases, PRK1 and PRK2, display extensive identity to each other, revealing non-kinase domain similar regions. HR1 and HR2. HR1 contains a motif repeated three times (HR1a-c), while HR2 shows similarity to the amino-terminal sequence of protein-kinase-C epsilon and eta isotypes. Both PRK1 and PRK2, expressed in COS 1 cells, are autophosphorylated in immunoprecipitates, indicating intrinsic kinase activity. PRK1 and PRK2, as well as a third member of this family, PRK3, show distinct patterns of expression in adult tissues.

• Hommel U, Zurini M, Luyten M
• Solution structure of a cysteine rich domain of rat protein kinase C.
• Nat Struct Biol. 1994; 1: 383-7

Intracellular protein phosphorylation by protein kinase C (PKC) plays a major role in the translation of extracellular signals into cellular events. Speculations on the structural basis for PKC activation are based on sequence homology between their cysteine-rich domains (CRD) and the DNA-binding 'zinc-fingers'. We produced a fragment comprising the second CRD (CRD2) of rat PKC-alpha and determined its three-dimensional structure in solution by NMR spectroscopy. This revealed that CRD2 adopts a globular fold allowing two non-consecutive sets of zinc-binding residues to form two separate metal-binding sites. The fold is different to those previously proposed and allows insight into the molecular topology of a family of homologous proteins.

• Hall C et al.
• Novel human brain cDNA encoding a 34,000 Mr protein n-chimaerin, related to both the regulatory domain of protein kinase C and BCR, the product of the breakpoint cluster region gene.
• J Mol Biol. 1990; 211: 11-6

A novel human brain complementary DNA sequence encodes n-chimaerin, a 34,000 Mr protein. A single cysteine-rich sequence CX2CX13CX2CX7CX7C in the N-terminal half of n-chimaerin shares almost 50% identity with corresponding sequences in the C1 regulatory domain of protein kinase C. The C-terminal half of n-chimaerin has 42% identity with the C-terminal region (amino acid residues 1050 to 1225) of BCR, the product of the breakpoint cluster region gene involved in Philadelphia (Ph') chromosome translocation. n-Chimaerin mRNA (2.2 x 10(3) base-pairs) is specifically expressed in the brain, with the highest amounts being in the hippocampus and cerebral cortex. The mRNA has a neuronal distribution and is expressed in neuroblastoma cells, but not in C6 glioma or primary astrocyte cultures. The similarity of two separate regions of n-chimaerin to domains of protein kinase C and BCR has intriguing implications with respect to its evolutionary origins, its function in the brain and potential phorbol-ester-binding properties.

• Ono Y et al.
• Phorbol ester binding to protein kinase C requires a cysteine-rich zinc-finger-like sequence.
• Proc Natl Acad Sci U S A. 1989; 86: 4868-71

Protein kinase C normally has a tandem repeat of a characteristic cysteine-rich sequence in C1, the conserved region of the regulatory domain. These sequences resemble the DNA-binding zinc finger domain. For the gamma subspecies of rat brain protein kinase C, various deletion and point mutants in this domain were constructed, and the mutated proteins were expressed in Escherichia coli by using the T7 expression system. Radioactive phorbol 12,13-dibutyrate binding analysis indicated that a cysteine-rich zinc-finger-like sequence was essential for protein kinase C to bind phorbol ester and that one of two sequences was sufficient for the phorbol ester binding. Conserved region C2, another region in the regulatory domain, was apparently needed for the enzyme to require Ca2+ for phorbol ester binding activity.

Disease (disease genes where sequence variants are found in this domain)

SwissProt sequences and OMIM curated human diseases associated with missense mutations within the C1 domain.

Protein	Disease
Protein kinase C gamma type (P05129) (SMART)	OMIM:176980: PROTEIN KINASE C, GAMMA; PRKCG

Metabolism (metabolic pathways involving proteins which contain this domain)

% proteins involved	KEGG pathway ID	Description
6.11	map04070	Phosphatidylinositol signaling system
5.53	map04510	Focal adhesion
4.88	map04530	Tight junction
4.73	map04670	Leukocyte transendothelial migration
4.73	map04010	MAPK signaling pathway
4.73	map04650	Natural killer cell mediated cytotoxicity
4.29	map05223	Non-small cell lung cancer
4.00	map04810	Regulation of actin cytoskeleton
4.00	map00564	Glycerophospholipid metabolism
4.00	map00561	Glycerolipid metabolism
3.49	map05214	Glioma
3.49	map04720	Long-term potentiation
3.49	map04012	ErbB signaling pathway
3.49	map04730	Long-term depression
3.28	map04310	Wnt signaling pathway
2.55	map04370	VEGF signaling pathway
2.55	map04916	Melanogenesis
2.55	map04540	Gap junction
2.40	map04910	Insulin signaling pathway
2.04	map05219	Bladder cancer
2.04	map04020	Calcium signaling pathway
1.75	map04664	Fc epsilon RI signaling pathway
1.46	map05213	Endometrial cancer
1.46	map05212	Pancreatic cancer
1.46	map05220	Chronic myeloid leukemia
1.46	map05210	Colorectal cancer
1.46	map05215	Prostate cancer
1.46	map05211	Renal cell carcinoma
1.46	map05221	Acute myeloid leukemia
1.46	map05218	Melanoma
1.46	map04914	Progesterone-mediated oocyte maturation
1.24	map04662	B cell receptor signaling pathway
1.24	map04350	TGF-beta signaling pathway
1.24	map04360	Axon guidance
1.24	map04660	T cell receptor signaling pathway
0.51	map05216	Thyroid cancer
0.51	map04912	GnRH signaling pathway
0.51	map04150	mTOR signaling pathway
0.15	map00562	Inositol phosphate metabolism
0.07	map00632	Benzoate degradation via CoA ligation
0.07	map04320	Dorso-ventral axis formation

This information is based on mapping of SMART genomic protein database to KEGG orthologous groups. Percentage points are related to the number of proteins with C1 domain which could be assigned to a KEGG orthologous group, and not all proteins containing C1 domain. Please note that proteins can be included in multiple pathways, ie. the numbers above will not always add up to 100%.

Structure (3D structures containing this domain)

3D Structures of C1 domains in PDB

PDB code	Title
1faq	RAF-1 CYSTEINE RICH DOMAIN, NMR, 27 STRUCTURES
1far	RAF-1 CYSTEINE RICH DOMAIN, NMR, MINIMIZED AVERAGE STRUCTURE
1kbe	Solution structure of the cysteine-rich C1 domain of Kinase Suppressor of Ras
1kbf	Solution Structure of the Cysteine-Rich C1 Domain of Kinase Suppressor of Ras
1ptq	PROTEIN KINASE C DELTA CYS2 DOMAIN
1ptr	PROTEIN KINASE C DELTA CYS2 DOMAIN COMPLEXED WITH PHORBOL-13-ACETATE
1r79	Solution Structure of The C1 Domain of The Human Diacylglycerol Kinase Delta
1rfh	Solution structure of the C1 domain of Nore1, a novel Ras effector
1tbn	NMR STRUCTURE OF A PROTEIN KINASE C-G PHORBOL-BINDING DOMAIN, MINIMIZED AVERAGE STRUCTURE
1tbo	NMR STRUCTURE OF A PROTEIN KINASE C-G PHORBOL-BINDING DOMAIN, 30 STRUCTURES
1xa6	Crystal Structure of the Human Beta2-Chimaerin
1y8f	Solution structure of the munc13-1 C1-domain
2db6	Solution structure of RSGI RUH-051, a C1 domain of STAC3 from human cDNA
2e73	Solution structure of the phorbol esters/diacylglycerol binding domain of protein kinase C gamma
2eli	Solution structure of the second Phorbol esters/diacylglycerol binding domain of human Protein kinase C alpha type
2enn	Solution structure of the first C1 domain from human protein kinase C theta
2enz	Solution structure of the second C1 domain from human protein kinase C theta
2fnf	C1 domain of Nore1
2ku3	Solution structure of BRD1 PHD1 finger
2row	The C1 domain of ROCK II
2vrw	Critical structural role for the PH and C1 domains of the Vav1 exchange factor
2yuu	Solution structure of the first Phorbol esters/diacylglycerol binding domain of human Protein kinase C, delta
3bji	Structural Basis of Promiscuous Guanine Nucleotide Exchange by the T-Cell Essential Vav1
3cxl	Crystal structure of human chimerin 1 (CHN1)
3ky9	Autoinhibited Vav1
3pfq	Crystal Structure and Allosteric Activation of Protein Kinase C beta II
3uej	Structural and functional characterization of an anesthetic binding site in the second cysteine-rich domain of protein kinase Cdelta
3uey	Structural and functional characterization of an anesthetic binding site in the second cysteine-rich domain of protein kinase Cdelta
3uff	Structural and functional characterization of an anesthetic binding site in the second cysteine-rich domain of protein kinase Cdelta
3ugd	Structural and functional characterization of an anesthetic binding site in the second cysteine-rich domain of protein kinase C delta
3ugi	Structural and functional characterization of an anesthetic binding site in the second cysteine-rich domain of protein kinase C delta
3ugl	Structural and functional characterization of an anesthetic binding site in the second cysteine-rich domain of protein kinase C delta
4b6d	Structure of the atypical C1 domain of MgcRacGAP
4fkd	Identification of the Activator Binding Residues in the Second Cysteine-Rich Regulatory Domain of Protein Kinase C Theta
4l9m	Autoinhibited state of the Ras-specific exchange factor RasGRP1

Links (links to other resources describing this domain)

• PFAM: DAG_PE-bind
• INTERPRO: IPR002219