The domain within your query sequence starts at position 577 and ends at position 651; the E-value for the C8 domain shown below is 8.71e-20.

EKFAESNCEILLSSSGPFAACHQTVNPKFYHEECKKYTCSCENGQDCLCTVLGNYVKACA
EKEIYLVGWRDGLCE

C8

• SMART accession number: SM00832
• Description: This domain contains 8 conserved cysteine residues, but this family only contains 7 of them to overlaps with other domains. It is found in disease-related proteins including von Willebrand factor, Alpha tectorin, Zonadhesin and Mucin.
• Interpro abstract (IPR014853):

  The proteins in this entry contained a domain rich in positionally conserved cysteine residues. Most proteins contains 7 or 8 cysteine residues. The domain is found in disease-related proteins including von Willebrand factor, Alpha tectorin, Zonadhesin and Mucin. It is often found on proteins containing IPR001846 and IPR002919 .

There are 20065 C8 domains in 7663 proteins in SMART's nrdb database.

Cellular role (predicted cellular role)

Cellular role: metabolism

Metabolism (metabolic pathways involving proteins which contain this domain)

% proteins involved	KEGG pathway ID	Description
33.33	map04610	Complement and coagulation cascades
33.33	map04512	ECM-receptor interaction
33.33	map04510	Focal adhesion

This information is based on mapping of SMART genomic protein database to KEGG orthologous groups. Percentage points are related to the number of proteins with C8 domain which could be assigned to a KEGG orthologous group, and not all proteins containing C8 domain. Please note that proteins can be included in multiple pathways, ie. the numbers above will not always add up to 100%.

Links (links to other resources describing this domain)

• INTERPRO: IPR014853
• PFAM: C8