The domain within your query sequence starts at position 10 and ends at position 76; the E-value for the CAP_GLY domain shown below is 5.23e-32.

IGRRVEVNGEYATVRFCGAVPPVAGLWLGVEWDNPERGKHDGSHEGTMYFKCRHPTGGSF
VRPSKVN

CAP_GLY

CAP_GLY
SMART accession number:SM01052
Description: Cytoskeleton-associated proteins (CAPs) are involved in the organisation of microtubules and transportation of vesicles and organelles along the cytoskeletal network. A conserved motif, CAP-Gly, has been identified in a number of CAPs, including CLIP-170 and dynactins. The crystal structure of Caenorhabditis elegans F53F4.3 protein Q20728 CAP-Gly domain was recently solved (PUBMED:12221106). The domain contains three beta-strands. The most conserved sequence, GKNDG, is located in two consecutive sharp turns on the surface, forming the entrance to a groove (PUBMED:12221106).
Interpro abstract (IPR000938):

Cytoskeleton-associated proteins (CAPs) are involved in the organisation of microtubules and transportation of vesicles and organelles along the cytoskeletal network. A conserved glycine-rich domain, CAP-Gly, has been identified in a number of CAPs, including CLIP-170 and dynactins. The crystal structure of the Caenorhabditis elegans F53F4.3 protein CAP-Gly domain has been solved. The domain contains three beta-strands. The most conserved sequence, GKNDG, is located in two consecutive sharp turns on the surface, forming the entrance to a groove [ (PUBMED:12221106) ].

Family alignment:
View or

There are 17076 CAP_GLY domains in 12534 proteins in SMART's nrdb database.

Click on the following links for more information.