The domain within your query sequence starts at position 425 and ends at position 529; the E-value for the CO_deh_flav_C domain shown below is 8.06e-24.

SAFRQAQRQQNALAIVNSGMRVLFREGGGVIEELSILYGGVGSTIISAKNSCQRLIGRPW
NEGMLDTACRLVLDEVTLAASAPGGKVEFKRTLIISFLFKFYLEV

CO_deh_flav_C

CO dehydrogenase flavoprotein C-terminal domain
CO_deh_flav_C
SMART accession number:SM01092
Description: -
Interpro abstract (IPR005107):

Proteins containing this domain form structural complexes with other known families, such as IPR008274 and IPR001041 . The carbon monoxide (CO) dehydrogenase of Oligotropha carboxidovorans is a heterotrimeric complex composed of a apoflavoprotein, a molybdoprotein, and an iron-sulphur protein. It can be dissociated with sodium dodecylsulphate [ (PUBMED:10636886) ]. CO dehydrogenase catalyzes the oxidation of CO according to the following equation [ (PUBMED:11076018) ]: CO + H2O = CO2 + 2e + 2H+

Subunit S represents the iron-sulphur protein of CO dehydrogenase and is clearly divided into a C- and an N-terminal domain, each binding a [2Fe-2S] cluster [ (PUBMED:10430865) ].

Family alignment:
View or

There are 28996 CO_deh_flav_C domains in 28937 proteins in SMART's nrdb database.

Click on the following links for more information.