The domain within your query sequence starts at position 50 and ends at position 92; the E-value for the CUE domain shown below is 6.55e-15.

EFNQAMDDFKTMFPNMDYDIIECVLRANSGAVDATIDQLLQMN

CUE

Domain that may be involved in binding ubiquitin-conjugating enzymes (UBCs)
CUE
SMART accession number:SM00546
Description: CUE domains also occur in two protein of the IL-1 signal transduction pathway, tollip and TAB2. Ponting (Biochem. J.) "Proteins of the Endoplasmic reticulum" (in press)
Interpro abstract (IPR003892):

This domain promotes intramolecular monoubiquitination and has a dual role in mono- and poly-ubiquitination recognition, being involved in binding ubiquitin-conjugating enzymes (UBCs) [ (PUBMED:12573224) (PUBMED:12628920) (PUBMED:23665229) ]. CUE domains also occur in two proteins of the IL-1 signal transduction pathway, tollip and TAB2.

GO function:protein binding (GO:0005515)
Family alignment:
View or

There are 4656 CUE domains in 4564 proteins in SMART's nrdb database.

Click on the following links for more information.