The domain within your query sequence starts at position 845 and ends at position 1008; the E-value for the CYCLIN domain shown below is 2.86e-6.

VRLRDLCIKLDISDELRKKIWTCFEFSIIQCTELMMDRHLDQLLMCAIYVMAKVTKEDRS
FQNIMRCYRTQPQARSQVYRSVLIKGKRRNSGSSESRSHQNSPTELNTDRASRDSSPVMR
SNSTLPVPQPSSAPPTPTRLTGASSDVEEEERGDLIQFYNNIYR

CYCLIN

domain present in cyclins, TFIIB and Retinoblastoma
CYCLIN
SMART accession number:SM00385
Description: A helical domain present in cyclins and TFIIB (twice) and Retinoblastoma (once). A protein recognition domain functioning in cell-cycle and transcription control.
Interpro abstract (IPR013763):

This cyclin-like domain is found in cyclins, but it is also found as the core domain in transcription factor IIB (TFIIB) [ (PUBMED:7675079) ] and in the retinoblastoma tumour suppressor [ (PUBMED:17974914) ]. It consists of a duplication of a fold consisting of 5 helices, one of them surrounded by the others.

Family alignment:
View or

There are 61335 CYCLIN domains in 41443 proteins in SMART's nrdb database.

Click on the following links for more information.