The domain within your query sequence starts at position 29 and ends at position 118; the E-value for the Cadherin_pro domain shown below is 3.42e-36.

SCSPGFSSEVYTFPVPERHLERGHVLGRVRFEGCTGRPRTAFFSEDSRFKVATDGTITVK
RHLKLHKLETSFLVRARDSSHRELSTKVTL

Cadherin_pro

Cadherin prodomain like
Cadherin_pro
SMART accession number:SM01055
Description: Cadherins are a family of proteins that mediate calcium dependent cell-cell adhesion. They are activated through cleavage of a prosequence in the late Golgi. This domain corresponds to the folded region of the prosequence, and is termed the prodomain. The prodomain shows structural resemblance to the cadherin domain, but lacks all the features known to be important for cadherin-cadherin interactions (PUBMED:15130472).
Interpro abstract (IPR014868):

Cadherins are a group of proteins that mediate calcium dependent cell-cell adhesion. They are activated through cleavage of a prosequence in the late Golgi. The folded part of the prosequence (termed the prodomain) shows structural resemblance to cadherin adhesive domains, but lacks all the features known to be important for cadherin-cadherin interactions [ (PUBMED:15130472) ].

This entry represents the caderin prodomain.

Family alignment:
View or

There are 1917 Cadherin_pro domains in 1912 proteins in SMART's nrdb database.

Click on the following links for more information.