The domain within your query sequence starts at position 298 and ends at position 374; the E-value for the Costars domain shown below is 6.22e-45.

EHIYREIMELCFVIRTMARHRRDGKIQVTFGELFDRYVRISDKVVGILMRARKHGLVHFE
GEMLWQGRDDHVVITLL

Costars

Costars
SMART accession number:SM01283
Description: This domain is found both alone and at the C-terminus of actin-binding Rho-activating protein (ABRA). It binds to actin, and in muscle regulates the actin cytoskeleton and cell motility PMID:11983702, 20940261. It has a winged helix-like fold consisting of three alpha-helices and four antiparallel beta strands. Unlike typical winged helix proteins it does not bind to DNA, but contains a hydrophobic groove which may be responsible for interaction with other proteins PMID:21082705 .
Interpro abstract (IPR027817):

This domain is found both alone (in the costars family of proteins) and at the C terminus of actin-binding Rho-activating protein (ABRA). It binds to actin, and in muscle regulates the actin cytoskeleton and cell motility [ (PUBMED:11983702) (PUBMED:20940261) ]. It has a winged helix-like fold consisting of three alpha-helices and four antiparallel beta strands. Unlike typical winged helix proteins it does not bind to DNA, but contains a hydrophobic groove which may be responsible for interaction with other proteins [ (PUBMED:21082705) ].

Family alignment:
View or

There are 1244 Costars domains in 1240 proteins in SMART's nrdb database.

Click on the following links for more information.