The domain within your query sequence starts at position 10 and ends at position 94; the E-value for the DCP2 domain shown below is 4.23e-50.

GSVLDDLCSRFILHIPSEERDNAIRVCFQIELAHWFYLDFYMQNTPGLPQCGIRDFAKAV
FSHCPFLLPQGEDVEKILDEWKEYK

DCP2

Dcp2, box A domain
DCP2
SMART accession number:SM01125
Description: This domain is specific to mRNA decapping protein 2 and this region has been termed Box A ((PUBMED:12218187)). Removal of the cap structure is catalysed by the Dcp1-Dcp2 complex ((PUBMED:16341225)).
Interpro abstract (IPR007722):

This presumed domain is always found to the N-terminal side of the NUDIX hydrolase domain IPR000086 . This domain appears to be specific to mRNA decapping protein 2 (DCP2) P53550 and its close homologues. This region has been termed Box A [ (PUBMED:12218187) ].

GO function:manganese ion binding (GO:0030145), hydrolase activity (GO:0016787), RNA binding (GO:0003723)
Family alignment:
View or

There are 1620 DCP2 domains in 1620 proteins in SMART's nrdb database.

Click on the following links for more information.