The domain within your query sequence starts at position 208 and ends at position 351; the E-value for the DHHA2 domain shown below is 8.32e-17.
INVLQESQLSAQGLSLEQTMLKDLKELSDGEIKVAISTVNMTLEDYLLHGNITSDLKAFT DKFGFDVLILISSFTWEEQQRQQIAVYSQNLELCSQICCELEESQNPCLELEPFECGCDE ILVYQQEDPSVTSDQVFLLLKEVI
DHHA2 |
---|
SMART accession number: | SM01131 |
---|---|
Description: | This domain is often found adjacent to the DHH domain PF01368 and is called DHHA2 for DHH associated domain. This domain is diagnostic of DHH subfamily 2 members ((PUBMED:9478130)). The domain is about 120 residues long and contains a conserved DXK motif at its amino terminus. |
Interpro abstract (IPR004097): | This domain is called DHHA2 since it is often associated with the DHH domain ( IPR001667 ) and is diagnostic of DHH subfamily 2 members [ (PUBMED:9478130) ]. The domain is about 120 residues long and contains a conserved DXK motif at its amino terminus. It is present in inorganic pyrophosphatases and in exopolyphosphatase of Saccharomyces cerevisiae. |
GO component: | cytoplasm (GO:0005737) |
GO function: | pyrophosphatase activity (GO:0016462) |
Family alignment: |
There are 6950 DHHA2 domains in 6949 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Literature (relevant references for this domain)
- Structure (3D structures containing this domain)
- Links (links to other resources describing this domain)