The domain within your query sequence starts at position 208 and ends at position 351; the E-value for the DHHA2 domain shown below is 8.32e-17.

INVLQESQLSAQGLSLEQTMLKDLKELSDGEIKVAISTVNMTLEDYLLHGNITSDLKAFT
DKFGFDVLILISSFTWEEQQRQQIAVYSQNLELCSQICCELEESQNPCLELEPFECGCDE
ILVYQQEDPSVTSDQVFLLLKEVI

DHHA2

DHHA2
SMART accession number:SM01131
Description: This domain is often found adjacent to the DHH domain PF01368 and is called DHHA2 for DHH associated domain. This domain is diagnostic of DHH subfamily 2 members ((PUBMED:9478130)). The domain is about 120 residues long and contains a conserved DXK motif at its amino terminus.
Interpro abstract (IPR004097):

This domain is called DHHA2 since it is often associated with the DHH domain ( IPR001667 ) and is diagnostic of DHH subfamily 2 members [ (PUBMED:9478130) ]. The domain is about 120 residues long and contains a conserved DXK motif at its amino terminus. It is present in inorganic pyrophosphatases and in exopolyphosphatase of Saccharomyces cerevisiae.

GO component:cytoplasm (GO:0005737)
GO function:pyrophosphatase activity (GO:0016462)
Family alignment:
View or

There are 6950 DHHA2 domains in 6949 proteins in SMART's nrdb database.

Click on the following links for more information.