The domain within your query sequence starts at position 48 and ends at position 106; the E-value for the DKCLD domain shown below is 1.85e-32.

DTSQWPLLLKNFDKLNVRTAHYTPLPCGSNPLKREIGDYIRTGFINLDKPSNPSSHEVV

DKCLD

DKCLD (NUC011) domain
DKCLD
SMART accession number:SM01136
Description: This is a TruB_N/PUA domain associated N-terminal domain of Dyskerin-like proteins ((PUBMED:15112237)).
Interpro abstract (IPR012960):

This is an N-terminal domain of dyskerin-like proteins, which is often associated with the TruB N-terminal ( IPR002501 ) and PUA ( IPR002478 ) domains [ (PUBMED:15112237) ].

Family alignment:
View or

There are 3290 DKCLD domains in 3289 proteins in SMART's nrdb database.

Click on the following links for more information.