The domain within your query sequence starts at position 52 and ends at position 93; the E-value for the DM15 domain shown below is 6.61e-18.

GFTQQLYHRYRRKCLSERKRLGIGQSQEMNTLFRFWSFFLRD

DM15

Tandem repeat in fly CG14066 (La related protein), human KIAA0731 and worm R144.7. Unknown function.
DM15
SMART accession number:SM00684
Description: -
Interpro abstract (IPR006607):

This repeat is found in proteins that have not been characterised.

Family alignment:
View or

There are 4521 DM15 domains in 1532 proteins in SMART's nrdb database.

Click on the following links for more information.