The domain within your query sequence starts at position 772 and ends at position 873; the E-value for the DUF1041 domain shown below is 1.05e-51.
KKVVRKCLEKAALINYTRLTEYAKIEGPAEKETETMNQATPARKLEEVLHLAELCIEVLQ QNEEHHAEFLQAFAWWPDLLAEHAEKFWALFTVDMDTALEAQ
DUF1041Domain of Unknown Function (DUF1041) |
|---|
| SMART accession number: | SM01145 |
|---|---|
| Description: | This family consists of several eukaryotic domains of unknown function. Members of this family are often found in tandem repeats and co-occur with C1,C2 and PH (SM00109, SM00239, SM00233) domains. |
| Interpro abstract (IPR010439): | This entry represents a domain found in the calcium-dependent secretion activators that are involved in the exocytosis of vesicles filled with neurotransmitters and neuropeptides. They also may specifically mediate the Ca2+-dependent exocytosis of large dense-core vesicles (DCVs) and other dense-core vesicles by acting as a PtdIns(4,5)P2-binding protein that acts at prefusion step following ATP-dependent priming and participates in DCVs-membrane fusion [ (PUBMED:15820695) ]. However, it probably also participates in small clear synaptic vesicles (SVs) exocytosis and it is unclear whether its function is related to Ca2+ triggering [ (PUBMED:11516399) ]. This protein is often found in tandem repeats and co-occur with C2 domains IPR000008 Protein kinase C, phorbol ester/diacylglycerol binding regions IPR002219 and PH domains IPR001849 . |
| Family alignment: |
There are 3859 DUF1041 domains in 3851 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Structure (3D structures containing this domain)
- Links (links to other resources describing this domain)
