The domain within your query sequence starts at position 1252 and ends at position 1316; the E-value for the DUF1087 domain shown below is 2.98e-33.

VREEDKIEEIEREIIKQEENVDPDYWEKLLRHHYEQQQEDLARNLGKGKRVRKQVNYNDA
AQEDQ

DUF1087

DUF1087
SMART accession number:SM01147
Description: Members of this family are found in various chromatin remodelling factors and transposases. Their exact function is, as yet, unknown.
Interpro abstract (IPR009463):

This domain is found in various chromatin remodelling factors. Its function is, as yet, unknown.

Family alignment:
View or

There are 2152 DUF1087 domains in 2147 proteins in SMART's nrdb database.

Click on the following links for more information.