The domain within your query sequence starts at position 1270 and ends at position 1327; the E-value for the DUF1518 domain shown below is 1.08e-21.
SMDGVLAGSAMPQAPPQQFPYPANYGMGQPPEPAFGRGSSPPSAMMSSRMGPSQNAMV
DUF1518 |
---|
SMART accession number: | SM01151 |
---|---|
Description: | This domain, which is usually found tandemly repeated, is found various receptor co-activating proteins. |
Interpro abstract (IPR010011): | This domain, which is usually found tandemly repeated, is found various receptor co-activating proteins. |
GO component: | nucleus (GO:0005634) |
Family alignment: |
There are 1581 DUF1518 domains in 1234 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Links (links to other resources describing this domain)