The domain within your query sequence starts at position 52 and ends at position 372; the E-value for the DUF1693 domain shown below is 2.52e-218.

LSWPQVKRLDALLKEPIPIHGRGNFPTLSVQPQQIVQVVRSSLEEHGLRVHSVRLHGSAA
SHVLHPESGLGYKDLDLVFQMDLRSEVSFQLTKAVVLACLLDFLPAGVSRAKITPLTLKE
AYVQKLVKVCTDLDRWSLISLSNKSGKNVELKFVDSVRRQFEFSIDSFQIILDSLLLFGQ
CSSTPMSEAFHPTVTGESLYGDFAEALEHLQHRVIATRSPEEIRGGGLLKYCHLLVRGFR
PRPSTDVRALQRYMCSRFFIDFPDLVEQRRILERYLEAHFGGAEAARRYACLVTLHQVVN
ESTVCLMSHERRQTLDLIAML

DUF1693

Domain of unknown function (DUF1693)		 DUF1693
SMART accession number:SM01153
Description: This family contains many hypothetical proteins. It also includes four nematode prion-like proteins. This domain has been identified as part of the nucleotidyltransferase superfamily.
Interpro abstract (IPR012937):

This entry includes terminal nucleotidyltransferase 5A/B/C/D (TENT5A/B/C/D). In general, they contain a NTase (nucleotidyltransferase) domain, some members possess additional C-terminal PAP/OAS1 substrate binding domain [ (PUBMED:19833706) ]. They are active non-canonical poly(A) polymerases, which modify cytosolic and/or nuclear RNA 3' ends [ (PUBMED:27060136) ]. They have different functions in many tissues at various stages of development.

Human TENT5A is a SMAD signalling pathway related protein, where SMADs are intercellular effectors of transforming growth factor-beta (TGF-beta) [ (PUBMED:19833706) ]. The TENT5C gene is one of the most frequently mutated genes in multiple myeloma. TENT5C acts as an onco-suppressor in multiple myeloma [ (PUBMED:28931820) ]. TENT5C also seems to enhance replication of some viruses, including yellow fever virus, in response to type I interferon [ (PUBMED:17803723) ].

GO function:RNA adenylyltransferase activity (GO:1990817)
Family alignment:
View or

There are 1596 DUF1693 domains in 1586 proteins in SMART's nrdb database.

Click on the following links for more information.