The domain within your query sequence starts at position 1526 and ends at position 1591; the E-value for the DUF1771 domain shown below is 1.88e-21.
EYDDYRAEAFLHQQKRMECYSKAKEAYRMGKKNVATFYAQQGSLHEQKMKEANHLAAVEI FEKVNA
DUF1771 |
---|
SMART accession number: | SM01162 |
---|---|
Description: | This domain is always found adjacent to SMR (SM00463). |
Interpro abstract (IPR013899): | This domain is almost always found adjacent to IPR002625 . |
Family alignment: |
There are 2910 DUF1771 domains in 2907 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Links (links to other resources describing this domain)