The domain within your query sequence starts at position 907 and ends at position 1049; the E-value for the DUF1866 domain shown below is 1.24e-80.
DIDIFEVEAEERQKIYKEVIAVQGPPDGTVLVSIKSSAQESTFFDDALIDELLRQFAHFG EVILIRFVEDKMWVTFLEGSSALNALSLNGKELLNRTITITLKSPDWIKHLEEEMSLEKI SVTLPSSASSTLLGEDAEVAADF
DUF1866 |
|---|
| SMART accession number: | SM01165 |
|---|---|
| Description: | This domain, found in Synaptojanin, has no known function. |
| Interpro abstract (IPR015047): | This domain can be found in Synaptojanin. Synaptojanin is a phosphoinositide phosphatase known to play an important role in vesicle recycling by promoting the uncoating of clathrin following synaptic vesicle uptake [ (PUBMED:10931870) (PUBMED:27559170) ]. |
| Family alignment: |
There are 1216 DUF1866 domains in 1215 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Structure (3D structures containing this domain)
- Links (links to other resources describing this domain)
