SMART: DUF1900 domain annotation

ALASVTLDTSPGPLIPLLDPDSGLLVLAGKGENQLYCYEVTPQQPALSPVTQCILENVLR
GAALVPRRALAVMSCEVLQVLQLSDTAIIPISHHVPRKAVEFHEDLFPDTAGSVPASDAH
MWWAGDNQQVQKVSL

DUF1900

SMART accession number:	SM01167
Description:	This domain is predominantly found in the structural protein coronin, and is duplicated in some sequences. It has no known function [(PUBMED:16172398)].
Family alignment:	View or

There are 5206 DUF1900 domains in 4443 proteins in SMART's nrdb database.

Click on the following links for more information.

Evolution (species in which this domain is found)
Taxonomic distribution of proteins containing DUF1900 domain.
This tree includes only several representative species. The complete taxonomic breakdown of all proteins with DUF1900 domain is also avaliable.

Click on the protein counts, or double click on taxonomic names to display all proteins containing DUF1900 domain in the selected taxonomic class.
Structure (3D structures containing this domain)
3D Structures of DUF1900 domains in PDB
PDB code Main view Title
2aq5 Crystal Structure of Murine Coronin-1

2b4e Crystal Structure of Murine Coronin-1: monoclinic form

4ozu 4OZU
Links (links to other resources describing this domain)
PFAM DUF1900

PDB code	Main view	Title
2aq5		Crystal Structure of Murine Coronin-1
2b4e		Crystal Structure of Murine Coronin-1: monoclinic form
4ozu		4OZU

DUF1900