The domain within your query sequence starts at position 854 and ends at position 1024; the E-value for the DUF3385 domain shown below is 1.51e-93.
VVEPYRKYPTLLEVLLNFLKTEQNQGTRREAIRVLGLLGALDPYKHKVNIGMIDQSRDAS AVSLSESKSSQDSSDYSTSEMLVNMGNLPLDEFYPAVSMVALMRIFRDQSLSHHHTMVVQ AITFIFKSLGLKCVQFLPQVMPTFLNVIRVCDGAIREFLFQQLGMLVSFVK
DUF3385Domain of unknown function |
---|
SMART accession number: | SM01346 |
---|---|
Description: | This domain is found in eukaryotes. |
Interpro abstract (IPR024585): | This uncharacterised domain is is typically between 160 to 172 amino acids in length. It is found in the phosphatidylinositol kinase-related protein kinases TOR (target of rapamycin). In Saccharomyces cerevisiae the TOR proteins, TOR1 and TOR2, regulate growth in a rapamycin-sensitive manner [ (PUBMED:12408816) ]. |
Family alignment: |
There are 1788 DUF3385 domains in 1786 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Structure (3D structures containing this domain)
- Links (links to other resources describing this domain)