The domain within your query sequence starts at position 70 and ends at position 212; the E-value for the DUF3452 domain shown below is 5.14e-78.

SIIPTVGKGVMEGNCVSLTRILRSAKLSLIQFFSKMKKWMDMSNLPQEFRERIERLERNF
EVSTVIFKKFEPIFLDIFQNPYEEPPKLPRSRKQRRIPCSVKDLFNFCWTLFVYTKGNFR
MIGDDLVNSYHLLLCCLDLIFAN

DUF3452

Domain of unknown function (DUF3452)
DUF3452
SMART accession number:SM01367
Description: This domain is functionally uncharacterised. This domain is found in bacteria and eukaryotes.
Interpro abstract (IPR024599):

This domain is found in N-terminal of the retinoblastoma-associated protein. It is found in association with IPR002720 and IPR002719 . This domain is typically between 124 to 150 amino acids in length and has a single completely conserved residue W that may be functionally important.

Family alignment:
View or

There are 1723 DUF3452 domains in 1722 proteins in SMART's nrdb database.

Click on the following links for more information.