The domain within your query sequence starts at position 94 and ends at position 236; the E-value for the DUF3452 domain shown below is 2.36e-77.

KSVPTVSKGTAEGNYVSLTRILRCSEQSLIEFFNKMKKWEDMANLPPHFRERTERLERNF
TVSAVIFKKYEPIFQDIFKYPQEEQPRQQRGRKQRRQPCTTSEIFHFCWVLFIYAKGNFP
MISDDLVNSYHLLLCALDLVYGN

DUF3452

Domain of unknown function (DUF3452)

• SMART accession number: SM01367
• Description: This domain is functionally uncharacterised. This domain is found in bacteria and eukaryotes.
• Interpro abstract (IPR024599):

  This domain is found in N-terminal of the retinoblastoma-associated protein. It is found in association with IPR002720 and IPR002719 . This domain is typically between 124 to 150 amino acids in length and has a single completely conserved residue W that may be functionally important.

There are 1723 DUF3452 domains in 1722 proteins in SMART's nrdb database.

Structure (3D structures containing this domain)

3D Structures of DUF3452 domains in PDB

PDB code	Title
2qdj	Crystal structure of the Retinoblastoma protein N-domain provides insight into tumor suppression, ligand interaction and holoprotein architecture
4elj	Crystal structure of the inactive retinoblastoma protein phosphorylated at T373

Links (links to other resources describing this domain)

• PFAM: DUF3452
• INTERPRO: IPR024599