The domain within your query sequence starts at position 2453 and ends at position 2517; the E-value for the DUF3454 domain shown below is 2.01e-30.
TTQFLTPPSQHSYSSSPVDNTPSHQLQVPEHPFLTPSPESPDQWSSSSPHSNISDWSEGI SSPPT
DUF3454Domain of unknown function |
---|
SMART accession number: | SM01334 |
---|---|
Description: | - |
Interpro abstract (IPR024600): | This functionally uncharacterised domain is found in notch and notch-related proteins. |
Family alignment: |
There are 1108 DUF3454 domains in 1107 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Links (links to other resources describing this domain)