The domain within your query sequence starts at position 1068 and ends at position 1212; the E-value for the DUF3585 domain shown below is 4.25e-61.
KDTSQYVVGELAALENEQKQIDTRAALVEKRLRYLMDTGRNTEEEEAMMQEWFMLVNKKN ALIRRMNQLSLLEKEHDLERRYELLNRELRAMLAIEDWQKTEAQKRREQLLLDELVALVD KRDALVRDLDAQEKQAEEEDEHLER
DUF3585 |
---|
SMART accession number: | SM01203 |
---|---|
Description: | This domain is found in eukaryotes. This domain is typically between 135 and 149 amino acids in length and is found associated with the CH domain. |
Family alignment: |
There are 6259 DUF3585 domains in 6259 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Cellular role (predicted cellular role)
- Structure (3D structures containing this domain)
- Links (links to other resources describing this domain)