SMART: DUF3585 domain annotation

FCKAQAIQRRLNEIEATMRELEAEGTKLELALRKESSSPEQQKKLWLDQLLRLIQKKNSL
VTEEAELMITVQELDLEEKQRQLDHELRGYMNREETMKTEADLQSENQVLRKLLEVVNQR
DALIQFQEERRLREMPA

DUF3585

SMART accession number:	SM01203
Description:	This domain is found in eukaryotes. This domain is typically between 135 and 149 amino acids in length and is found associated with the CH domain.
Family alignment:	View or

There are 6259 DUF3585 domains in 6259 proteins in SMART's nrdb database.

Click on the following links for more information.

Evolution (species in which this domain is found)
Taxonomic distribution of proteins containing DUF3585 domain.
This tree includes only several representative species. The complete taxonomic breakdown of all proteins with DUF3585 domain is also avaliable.

Click on the protein counts, or double click on taxonomic names to display all proteins containing DUF3585 domain in the selected taxonomic class.
Cellular role (predicted cellular role)
Cellular role: signalling
Structure (3D structures containing this domain)
3D Structures of DUF3585 domains in PDB
PDB code Main view Title
5lpn 5LPN

5szg 5SZG

5szh 5SZH

5szi 5SZI

5szj 5SZJ

5szk 5SZK
Links (links to other resources describing this domain)
PFAM DUF3585

DUF3585