The domain within your query sequence starts at position 1451 and ends at position 1555; the E-value for the DUF4208 domain shown below is 1.85e-52.

SEPVPIGEDEDDDLDQETFSICKERMRPVKKALKQLDKPDKGLSVQEQLEHTRNCLLKIG
DRIAECLKAYSDQEHIKLWRRNLWIFVSKFTEFDARKLHKLYKMA

DUF4208

DUF4208
SMART accession number:SM01176
Description: This domain is found at the C-terminus of chromodomain-helicase-DNA-binding proteins. The exact function of the domain is undetermined.
Interpro abstract (IPR025260):

This domain is often found at the C terminus of chromodomain-helicase-DNA-binding proteins. The function of the domain is undetermined.

Family alignment:
View or

There are 2238 DUF4208 domains in 2236 proteins in SMART's nrdb database.

Click on the following links for more information.