The domain within your query sequence starts at position 31 and ends at position 134; the E-value for the DUF4208 domain shown below is 1.43e-35.
VPTGDALVRHAKGLSQDTFKICKEYLRPLKKFLRKLNLPKDLPQKKRIKYTKQSLEALGG HINTFLQHYCRAWEIKHWKKMLWRFVSLFSELEAKQLRRLYKYT
DUF4208 |
|---|
| SMART accession number: | SM01176 |
|---|---|
| Description: | This domain is found at the C-terminus of chromodomain-helicase-DNA-binding proteins. The exact function of the domain is undetermined. |
| Interpro abstract (IPR025260): | This domain is often found at the C terminus of chromodomain-helicase-DNA-binding proteins. The function of the domain is undetermined. |
| Family alignment: |
There are 2238 DUF4208 domains in 2236 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Structure (3D structures containing this domain)
- Links (links to other resources describing this domain)
