The domain within your query sequence starts at position 556 and ends at position 621; the E-value for the DUF4217 domain shown below is 6.21e-22.
VLQTVFEDYVHSSQRMVSWAKKALQSFIRAYATYPKELKSIFHVRALHLGHVAKSFGLRD APRNLS
DUF4217 |
|---|
| SMART accession number: | SM01178 |
|---|---|
| Description: | This short domain is found at the C-terminus of many helicase proteins. |
| Interpro abstract (IPR025313): | This short domain is found at the C terminus of many helicases, including some DEAD box helicases. The DEAD box helicases are involved in various aspects of RNA metabolism, including nuclear transcription, pre mRNA splicing, ribosome biogenesis, nucleocytoplasmic transport, translation, RNA decay and organellar gene expression. |
| Family alignment: |
There are 6786 DUF4217 domains in 6779 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Links (links to other resources describing this domain)