The domain within your query sequence starts at position 88 and ends at position 342; the E-value for the DZF domain shown below is 3.87e-166.
TLRGVMRVGLVAKGLLLKGDLDLELVLLCKEKPTTALLDKVADNLAIQLTTVTEDKYEIL QSVDDAAIVIKNTKEPPLSLTIHLTSPVVREEMEKVLAGETLSVNDPPDVLDRQKCLAAL ASLRHAKWFQARANGLKSCVIVIRVLRDLCTRVPTWGPLRGWPLELLCEKSIGTANRPMG AGEALRRVLECLASGIVMPDGSGIYDPCEKEATDAIGHLDRQQREDITQSAQHALRLAAF GQLHKVLGMDPLPSK
DZFdomain in DSRM or ZnF_C2H2 domain containing proteins |
---|
SMART accession number: | SM00572 |
---|---|
Description: | - |
Interpro abstract (IPR006561): | This entry represents the DZF domain, which is found exclusively in the metazoa. The DZF domain (domain associated with zinc fingers) is a dimerisation domain found in [ (PUBMED:11438540) (PUBMED:11779830) (PUBMED:22833610) ]:
Nuclear factors NF90 and NF45 form a protein complex involved in a variety of cellular processes and are thought to affect gene expression both at the transcriptional and translational level. In addition, this complex affects the replication of several viruses through direct interactions with viral RNA. NF90 and NF45 dimerize through their common DZF domain. The DZF domain shows structural similarity to the template-free nucleotidyltransferase family of RNA modifying enzymes. However, the lack of conserved catalytic residues suggests that the DZF domain encodes a 'pseudotransferase' that is no longer able to catalyze transfer of nucleotides. The DZF dimerisation domain form an oblong structure with a flat face on one side and a curved face on the other. The DZF domain is bipartite and characterised by an N-terminal mixed alpha-beta region that contains a central anti-parallel beta-sheet and a C-terminal alpha-helical region. The overall structure has a pseudo two-fold rotational symmetry. The central beta-sheet forms the base of a cleft between the N- and C-terminal halves while dimerization is mediated by the alpha-helices at the C terminus [ (PUBMED:22833610) ]. |
Family alignment: |
There are 2259 DZF domains in 2259 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Literature (relevant references for this domain)
- Structure (3D structures containing this domain)
- Links (links to other resources describing this domain)