The domain within your query sequence starts at position 979 and ends at position 1035; the E-value for the DysFN domain shown below is 9.6e-25.

HLSFVEEVFENQTRLPGGQWIYMSDNYTDVNGEKVLPKDDIECPLGWKWEDEEWSTD

DysFN

Dysferlin domain, N-terminal region.
DysFN
SMART accession number:SM00693
Description: Domain of unknown function present in yeast peroxisomal proteins, dysferlin, myoferlin and hypothetical proteins. Due to an insertion of a dysferlin domain within a second dysferlin domain we have chosen to predict these domains in two parts: the N-terminal region and the C-terminal region.
Interpro abstract (IPR006614):

These two closely linked domains are found in ferlin gene family members and in peroxisomal membrane proteins (peroxins). The function of the domains is unknown.

GO component:integral component of membrane (GO:0016021)
Family alignment:
View or

There are 4167 DysFN domains in 2207 proteins in SMART's nrdb database.

Click on the following links for more information.