The domain within your query sequence starts at position 44 and ends at position 76; the E-value for the EGF_like domain shown below is 9.53e-2.

DIDECDIVPDACKGGMKCVNHYGGYLCLPKTAQ

EGF_like

EGF domain, unclasssified subfamily
EGF_like
SMART accession number:SM00001
Description: -
Family alignment:
View or

There are 116150 EGF_like domains in 57116 proteins in SMART's nrdb database.

Click on the following links for more information.