The domain within your query sequence starts at position 427 and ends at position 482; the E-value for the FF domain shown below is 2.22e-10.
RIEMKEKFKKTLEKIQFISPGQPWEEVMCFVMEDEAFKYITEADSKEVYGRHQREI
FFContains two conserved F residues |
---|
SMART accession number: | SM00441 |
---|---|
Description: | A novel motif that often accompanies WW domains. Often contains two conserved Phe (F) residues. |
Interpro abstract (IPR002713): | The FF domain may be involved in protein-protein interaction [ (PUBMED:10390614) ]. It often occurs as multiple copies and often accompanies WW domains IPR001202 . PRP40 from yeast encodes a novel, essential splicing component that associates with the yeast U1 small nuclear ribonucleoprotein particle [ (PUBMED:8622699) ]. |
Family alignment: |
There are 19195 FF domains in 4383 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Literature (relevant references for this domain)
- Metabolism (metabolic pathways involving proteins which contain this domain)
- Structure (3D structures containing this domain)
- Links (links to other resources describing this domain)