The domain within your query sequence starts at position 714 and ends at position 787; the E-value for the FerB domain shown below is 2.53e-45.

PQHTIPDVFIWMLSNNKRVAYARIAAKDLLYSPIEEQMGKHCGKIKTHFLKLPGKRPPGW
TVQAKVDIYLWLGS

FerB

FerB
SMART accession number:SM01201
Description: This is central domain B in proteins of the Ferlin family. PMID: 15112237
Interpro abstract (IPR012561):

The ferlin gene family are characterised by multiple tandem C2 domains and a C-terminal transmembrane domain. They are found in a wide range of species and their function remains unknown, however, mutations in its two most well-characterised members, dysferlin and otoferlin, have been implicated in human disease [ (PUBMED:20667140) ].

This is central domain B in proteins of the Ferlin family [ (PUBMED:15112237) ].

GO component:integral component of membrane (GO:0016021)
Family alignment:
View or

There are 3031 FerB domains in 3031 proteins in SMART's nrdb database.

Click on the following links for more information.