The domain within your query sequence starts at position 337 and ends at position 408; the E-value for the FerI domain shown below is 5.3e-39.

MDVGTVYREPRHAYLRKWLLLSDPDDFSAGARGYLKASLCVLGPGDEAPLDKKDPSEDKE
DIEGNLLRPTGV

FerI

FerI
SMART accession number:SM01202
Description: This domain is present in proteins of the Ferlin family. It is often located between two C2 domains PMID:15112237 .
Interpro abstract (IPR012968):

The ferlin gene family are characterised by multiple tandem C2 domains and a C-terminal transmembrane domain. They are found in a wide range of species and their function remains unknown, however, mutations in its two most well-characterised members, dysferlin and otoferlin, have been implicated in human disease [ (PUBMED:20667140) ].

This domain is present in proteins of the Ferlin family, which includes Otoferlin, Myoferlin and Dysferlin. It is often located between two C2 domains [ (PUBMED:15112237) ].

Family alignment:
View or

There are 3316 FerI domains in 3311 proteins in SMART's nrdb database.

Click on the following links for more information.