The domain within your query sequence starts at position 295 and ends at position 346; the E-value for the GRAN domain shown below is 1.19e-29.
CDMEVSCPEGYTCCRLNTGAWGCCPFAKAVCCEDHIHCCPAGFQCHTEKGTC
GRANGranulin |
---|
SMART accession number: | SM00277 |
---|---|
Description: | - |
Interpro abstract (IPR000118): | Metazoan granulins [ (PUBMED:1542665) ] are a family of cysteine-rich peptides of about 6 Kd which may have multiple biological activity. A precursor protein (known as acrogranin) potentially encodes seven different forms of granulin (grnA to grnG) which are probably released by post-translational proteolytic processing. Granulins are evolutionary related to PMP-D1, a peptide extracted from the pars intercerebralis of migratory locusts [ (PUBMED:1740125) ]. A schematic representation of the structure of a granulin is shown below:
In plants a granulin domain is often associated with the C terminus of cysteine proteases belong to the MEROPS peptidase family C1, subfamily C1A (papain). |
Family alignment: |
There are 5935 GRAN domains in 1625 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Structure (3D structures containing this domain)
- Links (links to other resources describing this domain)