The domain within your query sequence starts at position 7 and ends at position 72; the E-value for the G_gamma domain shown below is 2.19e-22.
TGSDIGQARRAVEQLRMEAGINRIKVSKAATDLLQFCTEQAKSDPFLVGIPAATNPFKEK KPCAIL
G_gammaGGL domain |
---|
SMART accession number: | SM01224 |
---|---|
Description: | G-protein gamma like domains (GGL) are found in the gamma subunit of the heterotrimeric G protein complex and in regulators of G protein signaling (RGS) proteins (PUBMED:9789084). It is also found fused to an inactive Galpha in the Dictyostelium protein gbqA (PUBMED:21182906). G-gamma likely shares a common origin with the helical N-terminal unit of G-beta (PUBMED:21182906). All organisms that posses a G-beta possess a G-gamma (PUBMED:21182906). |
Family alignment: |
There are 6344 G_gamma domains in 6337 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Structure (3D structures containing this domain)
- Links (links to other resources describing this domain)