The domain within your query sequence starts at position 406 and ends at position 518; the E-value for the GatB_Yqey domain shown below is 2.09e-22.
EFFQNVIKETRTEPKKVTNWVLNTFLCYLKQQNLAVSESPVTPSALAELLNLLDRKAISS SAAKQVFEELWKGEGKTAAQIVSEQQLELMQDQEALEKLCQTTIDGHPQVVTI
GatB_YqeyGatB domain |
|---|
| SMART accession number: | SM00845 |
|---|---|
| Description: | This domain is found in GatB and proteins related to bacterial Yqey. It is about 140 amino acid residues long. This domain is found at the C terminus of GatB which transamidates Glu-tRNA to Gln-tRNA. The function of this domain is uncertain. It does however suggest that Yqey and its relatives have a role in tRNA metabolism. |
| Interpro abstract (IPR018027): | The GatB domain, the function of which is uncertain, is associated with aspartyl/glutamyl amidotransferase subunit B and glutamyl amidotransferase subunit E. These are involved in the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln). |
| GO function: | carbon-nitrogen ligase activity, with glutamine as amido-N-donor (GO:0016884) |
| Family alignment: |
There are 19534 GatB_Yqey domains in 19534 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Cellular role (predicted cellular role)
- Metabolism (metabolic pathways involving proteins which contain this domain)
- Structure (3D structures containing this domain)
- Links (links to other resources describing this domain)
