The domain within your query sequence starts at position 189 and ends at position 307; the E-value for the HABP4_PAI-RBP1 domain shown below is 3.66e-45.

GKREFDRHSGSDRSGLKHEDKRGGSGSHNWGTVKDELTESPKYIQKQISYNCSDLDQSNV
TEETPEGEEHPVADTENKENEVEEVKEEGPKEMTLDEWKAIQNKDRAKVEFNIRKPNEG

HABP4_PAI-RBP1

Hyaluronan / mRNA binding family
HABP4_PAI-RBP1
SMART accession number:SM01233
Description: This family includes the HABP4 family of hyaluronan-binding proteins, and the PAI-1 mRNA-binding protein, PAI-RBP1. HABP4 has been observed to bind hyaluronan (a glucosaminoglycan), but it is not known whether this is its primary role in vivo. It has also been observed to bind RNA, but with a lower affinity than that for hyaluronan (PMID:10887182). PAI-1 mRNA-binding protein specifically binds the mRNA of type-1 plasminogen activator inhibitor (PAI-1), and is thought to be involved in regulation of mRNA stability (PMID:11001948). However, in both cases, the sequence motifs predicted to be important for ligand binding are not conserved throughout the family, so it is not known whether members of this family share a common function.
Interpro abstract (IPR006861):

This entry represents a domain found in the HABP4 protein family of hyaluronan-binding proteins, and the PAI-1 mRNA-binding protein, PAI-RBP1. HABP4 has been observed to bind hyaluronan (a glucosaminoglycan), but it is not known whether this is its primary role in vivo . It has also been observed to bind RNA, but with a lower affinity than that for hyaluronan [ (PUBMED:10887182) ]. PAI-1 mRNA-binding protein specifically binds the mRNA of type-1 plasminogen activator inhibitor (PAI-1), and is thought to be involved in regulation of mRNA stability [ (PUBMED:11001948) ]. However, in both cases, the sequence motifs predicted to be important for ligand binding are not conserved throughout the family, so it is not known whether members of this family share a common function.

Hyaluronan/mRNA-binding protein may be involved in nuclear functions such as the remodeling of chromatin and the regulation of transcription [ (PUBMED:14699138) (PUBMED:16455055) ].

Family alignment:
View or

There are 2755 HABP4_PAI-RBP1 domains in 2747 proteins in SMART's nrdb database.

Click on the following links for more information.