The domain within your query sequence starts at position 24 and ends at position 134; the E-value for the HATPase_c domain shown below is 5.78e0.

TTHAFLFGALAELIDNARDADATRIDIYAEKREDLQGGFMLCFLDNGVGMDPNDVINVIQ
FGKSAKRTPESTQIGRYGNGLKSGSMRIGKDFILFTKKENTMSCLFLSRTF

HATPase_c

Histidine kinase-like ATPases
HATPase_c
SMART accession number:SM00387
Description: Histidine kinase-, DNA gyrase B-, phytochrome-like ATPases.
Interpro abstract (IPR003594):

This domain is found in several ATP-binding proteins, including: histidine kinase [ (PUBMED:15157101) ], DNA gyrase B, topoisomerases [ (PUBMED:15105144) ], heat shock protein HSP90 [ (PUBMED:15292259) (PUBMED:14718169) (PUBMED:15217611) ], phytochrome-like ATPases and DNA mismatch repair proteins. The fold of this domain consists of two layers, alpha/beta, which contains an 8-stranded mixed beta-sheet.

Family alignment:
View or

There are 925732 HATPase_c domains in 922402 proteins in SMART's nrdb database.

Click on the following links for more information.