The domain within your query sequence starts at position 682 and ends at position 839; the E-value for the HELICc domain shown below is 1.4e-66.

YEYLRQVHAHWDKTGLLTRLSVRKKIFQEPKRASQVEQVLMAYSKCIMSCSHSEGHLTGA
LLLSVVGGKMSEGINFSDDLGRCVVMVGMPYPNIKSPELQEKMAYLNQTLPRTQGQPLPG
TVLIENLCMKAINQSIGRAIRHQRDFASIVLLDHRYAR

HELICc

helicase superfamily c-terminal domain
HELICc
SMART accession number:SM00490
Description: -
Interpro abstract (IPR001650):

Helicases have been classified in 5 superfamilies (SF1-SF5). For the two largest groups, commonly referred to as SF1 and SF2, a total of seven characteristic motifs has been identified [ (PUBMED:2546125) ]. These two superfamilies encompass a large number of DNA and RNA helicases from archaea, eubacteria, eukaryotes and viruses.

This entry represents the C-terminal domain found in proteins belonging to the helicase superfamilies 1 and 2. Included in this group is the eukaryotic translation initiation factor 4A (eIF4A), a member of the DEA(D/H)-box RNA helicase family. The structure of the carboxyl-terminal domain of eIF4A has been determined; it has a parallel alpha-beta topology that superimposes, with minor variations, on the structures and conserved motifs of the equivalent domain in other, distantly related helicases [ (PUBMED:11087862) ].

Family alignment:
View or

There are 429775 HELICc domains in 427751 proteins in SMART's nrdb database.

Click on the following links for more information.