The domain within your query sequence starts at position 125 and ends at position 196; the E-value for the HSA domain shown below is 5.4e-25.
PKVPEPPRPKGHWDYLCEEMQWLSADFAQERRWKRGVARKVVRMVIRHHEEQRQKEERAR REEQAKLRRIAS
HSAdomain in helicases and associated with SANT domains |
---|
SMART accession number: | SM00573 |
---|---|
Description: | - |
Interpro abstract (IPR014012): | The helicase/SANT-associated (HSA) domain is a predicted DNA-binding domain of ~75 amino acids [ (PUBMED:11779830) ], which is found in the eukaryotic SRCAP/p400/DOM and SNF2/brahma families [ (PUBMED:16024792) ]. While each family has the core sequences that define the HSA domain, they each also have additional sequences that distinguish these families from one another. For example, the sequence HWDY(L/C)EEEM(Q/V) is found in the SRCAP/p400/DOM family, whereas the sequence HQE(Y/F)LNSILQ is found in the SNF2 /brahma family [ (PUBMED:16024792) ]. In addition to the SANT and helicase domains, the HSA domain is also found in association with the bromo domain [ (PUBMED:11779830) ]. |
Family alignment: |
There are 2158 HSA domains in 2154 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Cellular role (predicted cellular role)
- Literature (relevant references for this domain)
- Metabolism (metabolic pathways involving proteins which contain this domain)
- Structure (3D structures containing this domain)
- Links (links to other resources describing this domain)