The domain within your query sequence starts at position 368 and ends at position 466; the E-value for the IPT domain shown below is 3.33e-15.

VPEILKKSLHSCSVKGEEEVFLIGKNFLKGTKVIFQENVSDENSWKSEAEIDMELFHQNH
LIVKVPPYHDQHITLPVSVGIYVVTNAGRSHDVQPFTYT

IPT

ig-like, plexins, transcription factors
IPT
SMART accession number:SM00429
Description: -
Interpro abstract (IPR002909):

The IPT (Ig-like, plexins, transcription factors) domain has an immunoglobulin like fold [ (PUBMED:10390613) ]. These domains are found in cell surface receptors such as Met and Ron as well as in intracellular transcription factors where it is involved in DNA binding. The Ron tyrosine kinase receptor shares with the members of its subfamily (Met and Sea) a unique functional feature: the control of cell dissociation, motility, and invasion of extracellular matrices (scattering) [ (PUBMED:8816464) ].

Family alignment:
View or

There are 37987 IPT domains in 14790 proteins in SMART's nrdb database.

Click on the following links for more information.