The domain within your query sequence starts at position 211 and ends at position 377; the E-value for the IRF-3 domain shown below is 1.13e-59.

DYSLLLTFIYGGRVVGKTQVHSLDCRLVAERSDSESSMEQVEFPKPDPLEPTQHLLNQLD
RGVLVASNSRGLFVQRLCPIPISWNAPEAPPGPGPHLLPSNKCVELFKTTYFCRDLAQYF
QGQGPPPKFQATLHFWEESPGSSHSQENLITVQMEQAFARHLLEKIP

IRF-3

Interferon-regulatory factor 3
IRF-3
SMART accession number:SM01243
Description: This is the interferon-regulatory factor 3 chain of the hetero-dimeric structure which also contains the shorter chain CREB-binding protein. These two subunits make up the DRAF1 (double-stranded RNA-activated factor 1). Viral dsRNA produced during viral transcription or replication leads to the activation of DRAF1. The DNA-binding specificity of DRAF1 correlates with transcriptional induction of ISG (interferon-alpha,beta-stimulated gene). IRF-3 preexists in the cytoplasm of uninfected cells and translocates to the nucleus following viral infection. Translocation of IRF-3 is accompanied by an increase in serine and threonine phosphorylation, and association with the CREB coactivator occurs only after infection.
Interpro abstract (IPR019471):

This is the interferon-regulatory factor 3 chain of the hetero-dimeric structure which also contains the shorter chain CREB-binding protein. These two subunits make up the DRAF1 (double-stranded RNA-activated factor 1). Viral dsRNA produced during viral transcription or replication leads to the activation of DRAF1. The DNA-binding specificity of DRAF1 correlates with transcriptional induction of ISG (interferon-alpha, beta-stimulated gene). IRF-3 pre-exists in the cytoplasm of uninfected cells and translocates to the nucleus following viral infection. Translocation of IRF-3 is accompanied by an increase in serine and threonine phosphorylation, and association with the CREB coactivator occurs only after infection [ (PUBMED:9488451) ].

GO process:regulation of transcription, DNA-templated (GO:0006355)
GO function:DNA-binding transcription factor activity (GO:0003700)
Family alignment:
View or

There are 2955 IRF-3 domains in 2950 proteins in SMART's nrdb database.

Click on the following links for more information.