The domain within your query sequence starts at position 211 and ends at position 377; the E-value for the IRF-3 domain shown below is 1.13e-59.
DYSLLLTFIYGGRVVGKTQVHSLDCRLVAERSDSESSMEQVEFPKPDPLEPTQHLLNQLD RGVLVASNSRGLFVQRLCPIPISWNAPEAPPGPGPHLLPSNKCVELFKTTYFCRDLAQYF QGQGPPPKFQATLHFWEESPGSSHSQENLITVQMEQAFARHLLEKIP
IRF-3Interferon-regulatory factor 3 |
---|
SMART accession number: | SM01243 |
---|---|
Description: | This is the interferon-regulatory factor 3 chain of the hetero-dimeric structure which also contains the shorter chain CREB-binding protein. These two subunits make up the DRAF1 (double-stranded RNA-activated factor 1). Viral dsRNA produced during viral transcription or replication leads to the activation of DRAF1. The DNA-binding specificity of DRAF1 correlates with transcriptional induction of ISG (interferon-alpha,beta-stimulated gene). IRF-3 preexists in the cytoplasm of uninfected cells and translocates to the nucleus following viral infection. Translocation of IRF-3 is accompanied by an increase in serine and threonine phosphorylation, and association with the CREB coactivator occurs only after infection. |
Interpro abstract (IPR019471): | This is the interferon-regulatory factor 3 chain of the hetero-dimeric structure which also contains the shorter chain CREB-binding protein. These two subunits make up the DRAF1 (double-stranded RNA-activated factor 1). Viral dsRNA produced during viral transcription or replication leads to the activation of DRAF1. The DNA-binding specificity of DRAF1 correlates with transcriptional induction of ISG (interferon-alpha, beta-stimulated gene). IRF-3 pre-exists in the cytoplasm of uninfected cells and translocates to the nucleus following viral infection. Translocation of IRF-3 is accompanied by an increase in serine and threonine phosphorylation, and association with the CREB coactivator occurs only after infection [ (PUBMED:9488451) ]. |
GO process: | regulation of transcription, DNA-templated (GO:0006355) |
GO function: | DNA-binding transcription factor activity (GO:0003700) |
Family alignment: |
There are 2955 IRF-3 domains in 2950 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Structure (3D structures containing this domain)
- Links (links to other resources describing this domain)