The domain within your query sequence starts at position 153 and ends at position 249; the E-value for the IRS domain shown below is 5.18e-36.
YMVTIRPTEASERCRLRGSYTLRTGVSALELWGGPEPGTQLYDWPYRFLRRFGRDKATFS FEAGRRCLSGEGNFEFETRHGNEIFQALEKVIAVQKN
IRSPhosphotyrosine-binding domain |
---|
SMART accession number: | SM01244 |
---|---|
Description: | - |
Family alignment: |
There are 6799 IRS domains in 6794 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Structure (3D structures containing this domain)
- Links (links to other resources describing this domain)