The domain within your query sequence starts at position 95 and ends at position 225; the E-value for the JAB_MPN domain shown below is 3.11e-42.
VVRLHPVILASIVDSYERRNEGAARVIGTLLGTVDKHSVEVTNCFSVPHNESEDEVAVDM EFAKNMYELHKKVSPNELILGWYATGHDITEHSVLIHEYYSREAPNPIHLTVDTGLQHGR MSIKAYVSTLM
JAB_MPNJAB/MPN domain |
---|
SMART accession number: | SM00232 |
---|---|
Description: | Domain in Jun kinase activation domain binding protein and proteasomal subunits. Domain at Mpr1p and Pad1p N-termini. Domain of unknown function. |
Interpro abstract (IPR000555): | This domain is known as the MPN domain [ (PUBMED:9644972) ], PAD-1-like domain [ (PUBMED:10369758) ], JABP1 domain [ (PUBMED:20838651) ] or JAMM domain [ (PUBMED:12183636) ]. Proteins with this domain include proteasome regulatory subunits, eukaryotic initiation factor 3 (eIF3) subunits and regulators of transcription factors. They are metalloenzymes that function as the ubiquitin isopeptidase/ deubiquitinase in the ubiquitin-based signaling and protein turnover pathways in eukaryotes [ (PUBMED:12183636) ]. Versions of the domain in prokaryotic cognates of the ubiquitin-modification pathway are predicted to have a similar role [ (PUBMED:16859499) ]. The archaeal (H. volcanii) JAMM domain containing protein, HvJAMM1, cleaves ubiquitin-like small archaeal modifier proteins (SAMP1/2) from protein conjugates [ (PUBMED:22970855) ]. The bacterial JAMM domain containing protein QbsD from Pseudomonas fluorescens cleaves the C-terminal amino acid residues of the sulfur carrier protein QbsE prior to the formation of the carboxy-terminal thiocarboxylate [ (PUBMED:17209031) ]. |
GO function: | isopeptidase activity (GO:0070122), metallopeptidase activity (GO:0008237), protein binding (GO:0005515) |
Family alignment: |
There are 21169 JAB_MPN domains in 21159 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Cellular role (predicted cellular role)
- Literature (relevant references for this domain)
- Metabolism (metabolic pathways involving proteins which contain this domain)
- Structure (3D structures containing this domain)
- Links (links to other resources describing this domain)