The domain within your query sequence starts at position 11 and ends at position 112; the E-value for the KLRAQ domain shown below is 8.01e-51.
QKLAQEYSKLRAQNQVLKKGVVDEQASSAALKEQLKMKDQSLRKLQQEMDSLTFRNLQLA KRVELLQDELALSEPRGKKNKKSGESSSQLSQEQKSVFDEDL
KLRAQPredicted coiled-coil domain-containing protein |
---|
SMART accession number: | SM01254 |
---|---|
Description: | This is the N-terminal 100 amino acid domain of a family of proteins conserved from nematodes to humans. It carries a characteristic KLRAQ sequence-motif. The function is unknown. |
Interpro abstract (IPR019343): | This entry represents a N-terminal 100 residues long domain, which contains a conserved KLRAQ motif. This domain is found in a family of coiled-coil domain-containing proteins that are conserved from nematodes to humans. These proteins also contain a C-terminal TTKRSYEDQ motif domain ( IPR019348 ). The function of these proteins is not known. |
Family alignment: |
There are 599 KLRAQ domains in 599 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Links (links to other resources describing this domain)