The domain within your query sequence starts at position 112 and ends at position 264; the E-value for the KRAP_IP3R_bind domain shown below is 2.99e-82.

PTLSRGTSFNSCYSTTGVPQSIPEWLEFWEKDPVEILLDLGFGADEPDICTQIPARFLGY
SSAARGINIHVFLEAQKQRMDFENPDLYGRFQQLEILDHVTNAFSSLLDGVKTQQNQHEE
KAERQAMQNPSSSGAKEHKRKMSQLLKRASRQT

KRAP_IP3R_bind

Ki-ras-induced actin-interacting protein-IP3R-interacting domain
KRAP_IP3R_bind
SMART accession number:SM01257
Description: This family includes the N-terminus of the actin-interacting protein sperm-specific antigen 2, or KRAP (Ki-ras-induced actin-interacting protein) (PUBMED:14673706). This region is found to be the residues that interact with inositol 1,4,5-trisphosphate receptor (IP3R). KRAP was first localized as a membrane-bound form with extracellular regions suggesting it might be involved in the regulation of filamentous actin and signals from the outside of the cells (PUBMED:14673706). It has now been shown to be critical for the proper subcellular localization and function of IP3R. Inositol 1,4,5-trisphosphate receptor functions as the Ca2+ release channel on specialized endoplasmic reticulum membranes, so the subcellular localisation of IP3R is crucial for its proper function (PUBMED:21501587).
Interpro abstract (IPR029325):

This domain entry includes the N terminus of the actin-interacting protein sperm-specific antigen 2 (SSFA2), also known as Ki-ras-induced actin-interacting protein (KRAP) [ (PUBMED:14673706) ]. In this region are found the residues that interact with inositol 1,4,5-trisphosphate receptor (IP3R, also known as ITPR). SSFA2 was first localised as a membrane-bound form with extracellular regions suggesting it might be involved in the regulation of filamentous actin and signals from the outside of the cells [ (PUBMED:14673706) ]. It has now been shown to be critical for the proper subcellular localisation and function of IP3R. Inositol 1,4,5-trisphosphate receptor functions as the Ca2+ release channel on specialised endoplasmic reticulum membranes, so the subcellular localisation of IP3R is crucial for its proper function [ (PUBMED:21501587) ].

This entry also recognises a domain in Tespa1 and in uncharacterized coiled-coil protein CCDC129. Tespa1 (thymocyte-expressed positive selection-associated protein 1) is required for the development and maturation of T-cells [ (PUBMED:22561606) ]. Tespa1 shows sequence homology to SSFA2 and physically associates with IP3R in T and B lymphocytes [ (PUBMED:23650607) ].

GO function:signaling receptor binding (GO:0005102)
Family alignment:
View or

There are 1163 KRAP_IP3R_bind domains in 1162 proteins in SMART's nrdb database.

Click on the following links for more information.