The domain within your query sequence starts at position 576 and ends at position 619; the E-value for the KRBA1 domain shown below is 7.71e-12.

QWPQEETATMPSPLHRLENSLRGILPVRPLRFTCVTGPGPSPSP

KRBA1

KRBA1 family repeat
KRBA1
SMART accession number:SM01258
Description: KRBA1 is a short repeating motif found in mammalian proteins. It is characterised by a highly conserved sequence of residues, SSPLxxLxxCLK. The function of the repeat, which can be present in up to seven copies, is unknown as is the function of the full length proteins.
Interpro abstract (IPR029317):

KRBA1 is a short repeating motif found in mammalian proteins. It is characterised by a highly conserved sequence of residues, SSPLxxLxxCLK. The function of the repeat, which can be present in up to seven copies, is unknown as is the function of the full length proteins.

Family alignment:
View or

There are 1771 KRBA1 domains in 335 proteins in SMART's nrdb database.

Click on the following links for more information.