The domain within your query sequence starts at position 586 and ends at position 629; the E-value for the KRBA1 domain shown below is 5.8e-16.
QWPQEETATMPSPLHRLENSLRGILPVRPLRFTCVTGPGPSPSP
KRBA1KRBA1 family repeat |
---|
SMART accession number: | SM01258 |
---|---|
Description: | KRBA1 is a short repeating motif found in mammalian proteins. It is characterised by a highly conserved sequence of residues, SSPLxxLxxCLK. The function of the repeat, which can be present in up to seven copies, is unknown as is the function of the full length proteins. |
Interpro abstract (IPR029317): | KRBA1 is a short repeating motif found in mammalian proteins. It is characterised by a highly conserved sequence of residues, SSPLxxLxxCLK. The function of the repeat, which can be present in up to seven copies, is unknown as is the function of the full length proteins. |
Family alignment: |
There are 1771 KRBA1 domains in 335 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Links (links to other resources describing this domain)