The domain within your query sequence starts at position 36 and ends at position 109; the E-value for the L51_S25_CI-B8 domain shown below is 8.78e-16.
TYGELGEGARKFVFFNIPQIQYKNPWVQIMMFKNMTPSPFLRFYLDSGEQVLVDVETKSN KEIMEHIKKILGKK
L51_S25_CI-B8Mitochondrial ribosomal protein L51 / S25 / CI-B8 domain |
---|
SMART accession number: | SM00916 |
---|---|
Description: | Proteins containing this domain are located in the mitochondrion and include ribosomal protein L51, and S25. This domain is also found in mitochondrial NADH-ubiquinone oxidoreductase B8 subunit (CI-B8) . It is not known whether all members of this family form part of the NADH-ubiquinone oxidoreductase and whether they are also all ribosomal proteins. |
Interpro abstract (IPR007741): | Proteins containing this domain are located in the mitochondrion and include ribosomal protein L51, and S25. This domain is also found in mitochondrial NADH-ubiquinone oxidoreductase B8 subunit (CI-B8) EC 1.6.5.3 . It is not known whether all members of this family form part of the NADH-ubiquinone oxidoreductase and whether they are also all ribosomal proteins. |
Family alignment: |
There are 3843 L51_S25_CI-B8 domains in 3831 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Cellular role (predicted cellular role)
- Structure (3D structures containing this domain)
- Links (links to other resources describing this domain)